PCYT1B purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PCYT1B MaxPab rabbit polyclonal antibody. Western Blot analysis of PCYT1B expression in human pancreas.
Western Blot (Cell lysate)
PCYT1B MaxPab rabbit polyclonal antibody. Western Blot analysis of PCYT1B expression in MCF-7.
Western Blot (Transfected lysate)
Western Blot analysis of PCYT1B expression in transfected 293T cell line (H00009468-T02) by PCYT1B MaxPab polyclonal antibody.
Lane 1: PCYT1B transfected lysate(41.90 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human PCYT1B protein.
Immunogen
PCYT1B (NP_004836.2, 1 a.a. ~ 369 a.a) full-length human protein.
Sequence
MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWKQMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISSMSEGDEDEK
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PCYT1B MaxPab rabbit polyclonal antibody. Western Blot analysis of PCYT1B expression in human pancreas.Western Blot (Cell lysate)
PCYT1B MaxPab rabbit polyclonal antibody. Western Blot analysis of PCYT1B expression in MCF-7.Western Blot (Transfected lysate)
Western Blot analysis of PCYT1B expression in transfected 293T cell line (H00009468-T02) by PCYT1B MaxPab polyclonal antibody.
Lane 1: PCYT1B transfected lysate(41.90 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PCYT1B
Entrez GeneID
9468GeneBank Accession#
NM_004845.3Protein Accession#
NP_004836.2Gene Name
PCYT1B
Gene Alias
CCT-beta, CTB
Gene Description
phosphate cytidylyltransferase 1, choline, beta
Omim ID
604926Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the cytidylyltransferase family. It is involved in the regulation of phosphatidylcholine biosynthesis. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
CTP:phosphocholine cytidylyltransferase b|OTTHUMP00000023086|phosphate cytidylyltransferase 1, choline, beta isoform
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com