Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PCYT1B polyclonal antibody (A01)

  • Catalog # : H00009468-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PCYT1B.
  • Immunogen:
  • PCYT1B (NP_004836, 236 a.a. ~ 314 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • NEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWKQMFQERSSRMLQAL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009468-A01
    Western Blot detection against Immunogen (34.8 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PCYT1B polyclonal antibody (A01), Lot # ABNOVA060525QCS1 Western Blot analysis of PCYT1B expression in A-431 ( Cat # L015V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9468
  • Gene Name:
  • PCYT1B
  • Gene Alias:
  • CCT-beta,CTB
  • Gene Description:
  • phosphate cytidylyltransferase 1, choline, beta
  • Gene Summary:
  • The protein encoded by this gene belongs to the cytidylyltransferase family. It is involved in the regulation of phosphatidylcholine biosynthesis. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • CTP:phosphocholine cytidylyltransferase b,OTTHUMP00000023086,phosphate cytidylyltransferase 1, choline, beta isoform
  • RSS
  • YouTube
  • Linkedin
  • Facebook