Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AKAP7 (Human) Recombinant Protein (P01)

  • Catalog # : H00009465-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human AKAP7 full-length ORF ( AAH16927, 1 a.a. - 81 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.65
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009465-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9465
  • Gene Name:
  • AKAP7
  • Gene Alias:
  • AKAP18
  • Gene Description:
  • A kinase (PRKA) anchor protein 7
  • Gene Summary:
  • This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined. [provided by RefSeq
  • Other Designations:
  • A-kinase anchor protein 7,A-kinase anchor protein 7 isoform alpha,A-kinase anchor protein 7, isoform alpha,A-kinase anchor protein 9 kDa,A-kinase anchor protein, 18-kD,A-kinase anchoring protein 18,OTTHUMP00000017200,OTTHUMP00000017201,OTTHUMP00000017202,
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook