FHL5 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of FHL5 expression in transfected 293T cell line (H00009457-T02) by FHL5 MaxPab polyclonal antibody.
Lane 1: FHL5 transfected lysate(32.80 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human FHL5 protein.
Immunogen
FHL5 (AAH21723.1, 1 a.a. ~ 284 a.a) full-length human protein.
Sequence
MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSDCRKDLCEEQFMSRDDYPFCMDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDI
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (86)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FHL5 expression in transfected 293T cell line (H00009457-T02) by FHL5 MaxPab polyclonal antibody.
Lane 1: FHL5 transfected lysate(32.80 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — FHL5
Entrez GeneID
9457GeneBank Accession#
BC021723.2Protein Accession#
AAH21723.1Gene Name
FHL5
Gene Alias
ACT, FLJ33049, KIAA0776, RP3-393D12.2, dJ393D12.2
Gene Description
four and a half LIM domains 5
Omim ID
605126Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is coordinately expressed with activator of cAMP-responsive element modulator (CREM). It is associated with CREM and confers a powerful transcriptional activation function. CREM acts as a transcription factor essential for the differentiation of spermatids into mature spermatozoa. There are multiple polyadenylation sites found in this gene. [provided by RefSeq
Other Designations
1700027G07Rik|LIM protein ACT|OTTHUMP00000016879|activator of cAMP-responsive element modulator (CREM) in testis
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com