MAP4K4 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human MAP4K4 partial ORF ( NP_663719, 611 a.a. - 710 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
VHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Interspecies Antigen Sequence
Mouse (95); Rat (89)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MAP4K4
Entrez GeneID
9448GeneBank Accession#
NM_145686Protein Accession#
NP_663719Gene Name
MAP4K4
Gene Alias
FLH21957, FLJ10410, FLJ20373, FLJ90111, HGK, KIAA0687, NIK
Gene Description
mitogen-activated protein kinase kinase kinase kinase 4
Omim ID
604666Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase has been shown to specifically activate MAPK8/JNK. The activation of MAPK8 by this kinase is found to be inhibited by the dominant-negative mutants of MAP3K7/TAK1, MAP2K4/MKK4, and MAP2K7/MKK7, which suggests that this kinase may function through the MAP3K7-MAP2K4-MAP2K7 kinase cascade, and mediate the TNF-alpha signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
HPK/GCK-like kinase|hepatocyte progenitor kinase-like/germinal center kinase-like kinase
-
Interactome
-
Pathway
-
Publication Reference
-
MAP4K4 induces early blood-brain barrier damage in a murine subarachnoid hemorrhage model.
Zheng Zou, Yu-Shu Dong, Dong-Dong Liu, Gen Li, Guang-Zhi Hao, Xu Gao, Peng-Yu Pan, Guo-Biao Liang.
Neural Regeneration Research 2021 Feb; 16(2):325.
Application：ICV injection, Mouse, Mouse.
-
MAP4K4 induces early blood-brain barrier damage in a murine subarachnoid hemorrhage model.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com