MAP4K4 monoclonal antibody (M07), clone 4A5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MAP4K4.
Immunogen
MAP4K4 (NP_663719, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (89)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MAP4K4 monoclonal antibody (M07), clone 4A5 Western Blot analysis of MAP4K4 expression in K-562 ( Cat # L009V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MAP4K4 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAP4K4 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — MAP4K4
Entrez GeneID
9448GeneBank Accession#
NM_145686Protein Accession#
NP_663719Gene Name
MAP4K4
Gene Alias
FLH21957, FLJ10410, FLJ20373, FLJ90111, HGK, KIAA0687, NIK
Gene Description
mitogen-activated protein kinase kinase kinase kinase 4
Omim ID
604666Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase has been shown to specifically activate MAPK8/JNK. The activation of MAPK8 by this kinase is found to be inhibited by the dominant-negative mutants of MAP3K7/TAK1, MAP2K4/MKK4, and MAP2K7/MKK7, which suggests that this kinase may function through the MAP3K7-MAP2K4-MAP2K7 kinase cascade, and mediate the TNF-alpha signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
HPK/GCK-like kinase|hepatocyte progenitor kinase-like/germinal center kinase-like kinase
-
Interactome
-
Pathway
-
Publication Reference
-
Intracellular Theileria annulata Promote Invasive Cell Motility through Kinase Regulation of the Host Actin Cytoskeleton.
Ma M, Baumgartner M.
PLoS Pathogens 2014 Mar; 10(3):e1004003.
Application:IF, Bovine, TaC12 cells.
-
Filopodia and Membrane Blebs Drive Efficient Matrix Invasion of Macrophages Transformed by the Intracellular Parasite Theileria annulata.
Ma M, Baumgartner M.
PLoS One 2013 Sep; 8(9):e75577.
Application:IF, Theileria annulata, TaH12810 cells.
-
Intracellular Theileria annulata Promote Invasive Cell Motility through Kinase Regulation of the Host Actin Cytoskeleton.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com