Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GSTO1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00009446-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human GSTO1 protein.
  • Immunogen:
  • GSTO1 (NP_004823.1, 1 a.a. ~ 241 a.a) full-length human protein.
  • Sequence:
  • MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse, Rat
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • GSTO1 MaxPab polyclonal antibody. Western Blot analysis of GSTO1 expression in HeLa.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • GSTO1 MaxPab polyclonal antibody. Western Blot analysis of GSTO1 expression in PC-12.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • GSTO1 MaxPab polyclonal antibody. Western Blot analysis of GSTO1 expression in Jurkat.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • GSTO1 MaxPab polyclonal antibody. Western Blot analysis of GSTO1 expression in NIH/3T3.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of GSTO1 expression in transfected 293T cell line (H00009446-T01) by GSTO1 MaxPab polyclonal antibody.

    Lane 1: GSTO1 transfected lysate(26.51 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9446
  • Gene Name:
  • GSTO1
  • Gene Alias:
  • DKFZp686H13163,GSTTLp28,P28
  • Gene Description:
  • glutathione S-transferase omega 1
  • Gene Summary:
  • This gene encodes a member of the theta class glutathione S-transferase-like (GSTTL) protein family. In mouse, the encoded protein acts as a small stress response protein, likely involved in cellular redox homeostasis. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000020429,glutathione S-transferase omega 1-1,glutathione transferase omega 1,glutathione-S-transferase like,glutathione-S-transferase omega 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook