CRSP9 monoclonal antibody (M01), clone 3E7

Catalog # H00009443-M01

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

CRSP9 monoclonal antibody (M01), clone 3E7 Western Blot analysis of CRSP9 expression in Jurkat ( Cat # L017V1 ).

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of CRSP9 expression in transfected 293T cell line by CRSP9 monoclonal antibody (M01), clone 3E7.

Lane 1: CRSP9 transfected lysate(27.2 KDa).
Lane 2: Non-transfected lysate.

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged CRSP9 is approximately 0.3ng/ml as a capture antibody.

RNAi Knockdown (Antibody validated)
Application

RNAi Knockdown (Antibody validated)

Western blot analysis of CRSP9 over-expressed 293 cell line, cotransfected with CRSP9 Validated Chimera RNAi ( Cat # H00009443-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CRSP9 monoclonal antibody (M01), clone 3E7 (Cat # H00009443-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

QC Test

Western Blot detection against Immunogen (51.37 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a full length recombinant CRSP9.

    Immunogen

    CRSP9 (AAH05250, 1 a.a. ~ 233 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP

    Host

    Mouse

    Reactivity

    Human

    Interspecies Antigen Sequence

    Mouse (96); Rat (97)

    Isotype

    IgG2b kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (51.37 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    CRSP9 monoclonal antibody (M01), clone 3E7 Western Blot analysis of CRSP9 expression in Jurkat ( Cat # L017V1 ).

    Western Blot (Transfected lysate)

    Western Blot analysis of CRSP9 expression in transfected 293T cell line by CRSP9 monoclonal antibody (M01), clone 3E7.

    Lane 1: CRSP9 transfected lysate(27.2 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged CRSP9 is approximately 0.3ng/ml as a capture antibody.

    ELISA

    RNAi Knockdown (Antibody validated)

    Western blot analysis of CRSP9 over-expressed 293 cell line, cotransfected with CRSP9 Validated Chimera RNAi ( Cat # H00009443-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CRSP9 monoclonal antibody (M01), clone 3E7 (Cat # H00009443-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • Gene Info — MED7

    Entrez GeneID

    9443

    GeneBank Accession#

    BC005250

    Protein Accession#

    AAH05250

    Gene Name

    MED7

    Gene Alias

    CRSP33, CRSP9, MGC12284

    Gene Description

    mediator complex subunit 7

    Omim ID

    605045

    Gene Ontology

    Hyperlink

    Gene Summary

    The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

    Other Designations

    OTTHUMP00000160735|cofactor required for Sp1 transcriptional activation, subunit 9 (33kD)|cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa

  • Interactome
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All