Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CRSP9 monoclonal antibody (M01), clone 3E7

  • Catalog # : H00009443-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant CRSP9.
  • Immunogen:
  • CRSP9 (AAH05250, 1 a.a. ~ 233 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009443-M01
    Western Blot detection against Immunogen (51.37 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CRSP9 monoclonal antibody (M01), clone 3E7 Western Blot analysis of CRSP9 expression in Jurkat ( Cat # L017V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CRSP9 expression in transfected 293T cell line by CRSP9 monoclonal antibody (M01), clone 3E7.

    Lane 1: CRSP9 transfected lysate(27.2 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged CRSP9 is approximately 0.3ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of CRSP9 over-expressed 293 cell line, cotransfected with CRSP9 Validated Chimera RNAi ( Cat # H00009443-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CRSP9 monoclonal antibody (M01), clone 3E7 (Cat # H00009443-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9443
  • Gene Name:
  • MED7
  • Gene Alias:
  • CRSP33,CRSP9,MGC12284
  • Gene Description:
  • mediator complex subunit 7
  • Gene Summary:
  • The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000160735,cofactor required for Sp1 transcriptional activation, subunit 9 (33kD),cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa
  • RSS
  • YouTube
  • Linkedin
  • Facebook