CRSP8 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CRSP8 full-length ORF ( AAH02878, 1 a.a. - 70 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
33.44
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MED27
Entrez GeneID
9442GeneBank Accession#
BC002878Protein Accession#
AAH02878Gene Name
MED27
Gene Alias
CRAP34, CRSP34, CRSP8, MGC11274, TRAP37
Gene Description
mediator complex subunit 27
Omim ID
605044Gene Ontology
HyperlinkGene Summary
The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. [provided by RefSeq
Other Designations
cofactor required for Sp1 transcriptional activation, subunit 8 (34kD)|cofactor required for Sp1 transcriptional activation, subunit 8, 34kDa|p37 TRAP/SMCC/PC2 subunit
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com