CRSP8 monoclonal antibody (M01), clone 8B8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CRSP8 monoclonal antibody (M01), clone 8B8 Western Blot analysis of CRSP8 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of CRSP8 expression in transfected 293T cell line by CRSP8 monoclonal antibody (M01), clone 8B8.
Lane 1: CRSP8 transfected lysate(35.4 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CRSP8 on formalin-fixed paraffin-embedded human colon. [antibody concentration 0.3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MED27 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.44 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CRSP8.
Immunogen
CRSP8 (AAH02878, 1 a.a. ~ 70 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.44 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CRSP8 monoclonal antibody (M01), clone 8B8 Western Blot analysis of CRSP8 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of CRSP8 expression in transfected 293T cell line by CRSP8 monoclonal antibody (M01), clone 8B8.
Lane 1: CRSP8 transfected lysate(35.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CRSP8 on formalin-fixed paraffin-embedded human colon. [antibody concentration 0.3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MED27 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — MED27
Entrez GeneID
9442GeneBank Accession#
BC002878Protein Accession#
AAH02878Gene Name
MED27
Gene Alias
CRAP34, CRSP34, CRSP8, MGC11274, TRAP37
Gene Description
mediator complex subunit 27
Omim ID
605044Gene Ontology
HyperlinkGene Summary
The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. [provided by RefSeq
Other Designations
cofactor required for Sp1 transcriptional activation, subunit 8 (34kD)|cofactor required for Sp1 transcriptional activation, subunit 8, 34kDa|p37 TRAP/SMCC/PC2 subunit
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com