CRSP7 monoclonal antibody (M06), clone 2G10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CRSP7 expression in transfected 293T cell line by CRSP7 monoclonal antibody (M06), clone 2G10.
Lane 1: CRSP7 transfected lysate(65.446 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MED26 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CRSP7.
Immunogen
CRSP7 (NP_004822, 501 a.a. ~ 600 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (85)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CRSP7 expression in transfected 293T cell line by CRSP7 monoclonal antibody (M06), clone 2G10.
Lane 1: CRSP7 transfected lysate(65.446 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MED26 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5 ug/ml]ELISA
-
Gene Info — MED26
Entrez GeneID
9441GeneBank Accession#
NM_004831Protein Accession#
NP_004822Gene Name
MED26
Gene Alias
CRSP7, CRSP70
Gene Description
mediator complex subunit 26
Omim ID
605043Gene Ontology
HyperlinkGene Summary
The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. [provided by RefSeq
Other Designations
cofactor required for Sp1 transcriptional activation, subunit 7 (70kD)|cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com