Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CRSP6 (Human) Recombinant Protein (Q01)

  • Catalog # : H00009440-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CRSP6 partial ORF ( AAH21101, 551 a.a. - 651 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • FSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQCKDLPKSDVLQDNKWSHLRGPFKEVQWNKMEGRNFVYKMELLMSALSPCLL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.85
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009440-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9440
  • Gene Name:
  • MED17
  • Gene Alias:
  • CRSP6,CRSP77,DRIP80,FLJ10812,TRAP80
  • Gene Description:
  • mediator complex subunit 17
  • Gene Summary:
  • The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. [provided by RefSeq
  • Other Designations:
  • cofactor required for Sp1 transcriptional activation, subunit 6 (77kD),cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa,thyroid hormone receptor-associated protein, 80-KD subunit,vitamin D receptor interacting protein 80-kD
  • RSS
  • YouTube
  • Linkedin
  • Facebook