CRSP6 monoclonal antibody (M01), clone 4D4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CRSP6.
Immunogen
CRSP6 (AAH21101, 551 a.a. ~ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQCKDLPKSDVLQDNKWSHLRGPFKEVQWNKMEGRNFVYKMELLMSALSPCLL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (96)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.85 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CRSP6 monoclonal antibody (M01), clone 4D4 Western Blot analysis of CRSP6 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CRSP6 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.2 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CRSP6 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CRSP6 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — MED17
Entrez GeneID
9440GeneBank Accession#
BC021101Protein Accession#
AAH21101Gene Name
MED17
Gene Alias
CRSP6, CRSP77, DRIP80, FLJ10812, TRAP80
Gene Description
mediator complex subunit 17
Omim ID
603810Gene Ontology
HyperlinkGene Summary
The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. [provided by RefSeq
Other Designations
cofactor required for Sp1 transcriptional activation, subunit 6 (77kD)|cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa|thyroid hormone receptor-associated protein, 80-KD subunit|vitamin D receptor interacting protein 80-kD
-
Interactome
-
Publication Reference
-
Human mediator MED17 subunit plays essential roles in gene regulation by associating with the transcription and DNA repair machineries.
Kikuchi Y, Umemura H, Nishitani S, Iida S, Fukasawa R, Hayashi H, Hirose Y, Tanaka A, Sugasawa K, Ohkuma Y.
Genes to cells 2015 Mar; 20(3):191.
Application:IS, WB-Tr, Human, MCF-7 cells.
-
Identification of target genes for the CDK subunits of the Mediator complex.
Tsutsui T, Fukasawa R, Tanaka A, Hirose Y, Ohkuma Y.
Genes to Cells 2011 Dec; 16(12):1208.
Application:WB-Tr, Human, HeLa cells.
-
Human mediator MED17 subunit plays essential roles in gene regulation by associating with the transcription and DNA repair machineries.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com