ABCG2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant ABCG2.
Immunogen
ABCG2 (NP_004818, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Sequence
MSSSNVEVFIPVSQGNTNGFPATVSNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVEKEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLING
Host
Mouse
Reactivity
Human, Mouse
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ABCG2 polyclonal antibody (A01), Lot # 051017JC01. Western Blot analysis of ABCG2 expression in Raw 264.7.Western Blot (Recombinant protein)
ELISA
-
Gene Info — ABCG2
Entrez GeneID
9429GeneBank Accession#
NM_004827Protein Accession#
NP_004818Gene Name
ABCG2
Gene Alias
ABC15, ABCP, BCRP, BCRP1, BMDP, CD338, CDw338, EST157481, MGC102821, MRX, MXR, MXR1
Gene Description
ATP-binding cassette, sub-family G (WHITE), member 2
Omim ID
603756Gene Ontology
HyperlinkGene Summary
The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue. [provided by RefSeq
Other Designations
ABC transporter|ATP-binding cassette transporter G2|ATP-binding cassette, sub-family G, member 2|breast cancer resistance protein|mitoxantrone resistance protein|placenta specific MDR protein
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com