CDYL monoclonal antibody (M02), clone 1A6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDYL.
Immunogen
CDYL (NP_004815.2, 153 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LVIGKDHESKNSQLFAASQKFRKNTAPSLSSRKNMDLAKSGIKILVPKSPVKSRTAVDGFQSESPEKLDPVEQGQEDTVAPEVAAEKPVGALLGPGAERARMGSRPRI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDYL is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CDYL on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — CDYL
Entrez GeneID
9425GeneBank Accession#
NM_004824Protein Accession#
NP_004815.2Gene Name
CDYL
Gene Alias
CDYL1, DKFZp586C1622, MGC131936
Gene Description
chromodomain protein, Y-like
Omim ID
603778Gene Ontology
HyperlinkGene Summary
Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene. Proteins encoded by this gene superfamily possess a chromodomain, a motif implicated in chromatin binding and gene suppression, and a catalytic domain believed to be involved in histone acetylation. Multiple proteins are encoded by transcript variants of this gene. [provided by RefSeq
Other Designations
CDY-like, autosomal|OTTHUMP00000015984|bA620A17.2 (chromodomain protein, Y chromosome-like)|chromodomain protein, Y chromosome-like|chromodomain protein, Y chromosome-like, isoform b|testis-specific chromodomain Y-like protein
-
Interactome
-
Disease
-
Publication Reference
-
Chemoproteomics profiling of HDAC inhibitors reveals selective targeting of HDAC complexes.
Bantscheff M, Hopf C, Savitski MM, Dittmann A, Grandi P, Michon AM, Schlegl J, Abraham Y, Becher I, Bergamini G, Boesche M, Delling M, Dumpelfeld B, Eberhard D, Huthmacher C, Mathieson T, Poeckel D, Reader V, Strunk K, Sweetman G, Kruse U, Neubauer G, Ramsden NG, Drewes G.
Nature Biotechnology 2011 Mar; 29(3):255.
Application:IP, Human, K-562 cells.
-
Chemoproteomics profiling of HDAC inhibitors reveals selective targeting of HDAC complexes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com