HAND1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HAND1 full-length ORF ( ABZ92217.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRELQQHEGFPPALGPVEKRIKGRTGWPQQVWALELNQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
23.7
Interspecies Antigen Sequence
Mouse (92); Rat (93)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HAND1
Entrez GeneID
9421GeneBank Accession#
EU446688.1Protein Accession#
ABZ92217.1Gene Name
HAND1
Gene Alias
Hxt, Thing1, bHLHa27, eHand
Gene Description
heart and neural crest derivatives expressed 1
Omim ID
602406Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, it has been suggested that this transcription factor may be required for early trophoblast differentiation. [provided by RefSeq
Other Designations
basic helix-loop-helix transcription factor HAND1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com