CYP7B1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CYP7B1 polyclonal antibody (A01), Lot # 060516JCS1 Western Blot analysis of CYP7B1 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
CYP7B1 polyclonal antibody (A01), Lot # 060516JCS1. Western Blot analysis of CYP7B1 expression in PC-12.
Western Blot detection against Immunogen (35.35 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant CYP7B1.
Immunogen
CYP7B1 (NP_004811, 203 a.a. ~ 286 a.a) partial recombinant protein with GST tag.
Sequence
CDNNKFISELRDDFLKFDDKFAYLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDLEIGAHH
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (67); Rat (66)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.35 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CYP7B1 polyclonal antibody (A01), Lot # 060516JCS1 Western Blot analysis of CYP7B1 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
CYP7B1 polyclonal antibody (A01), Lot # 060516JCS1. Western Blot analysis of CYP7B1 expression in PC-12.Western Blot (Recombinant protein)
ELISA
-
Gene Info — CYP7B1
Entrez GeneID
9420GeneBank Accession#
NM_004820Protein Accession#
NP_004811Gene Name
CYP7B1
Gene Alias
CBAS3, CP7B, SPG5A
Gene Description
cytochrome P450, family 7, subfamily B, polypeptide 1
Omim ID
603711Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway of extrahepatic tissues, which converts cholesterol to bile acids. This enzyme likely plays a minor role in total bile acid synthesis, but may also be involved in the development of atherosclerosis, neurosteroid metabolism and sex hormone synthesis. [provided by RefSeq
Other Designations
cytochrome P450, subfamily VIIB (oxysterol 7 alpha-hydroxylase), polypeptide 1|oxysterol 7alpha-hydroxylase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Increased hydrophilic plasma bile acids are correlated with protection from adiposity in skin-specific stearoyl-CoA desaturase-1 deficient mice.
Dumas SN, Ntambi JM.
PLoS One 2018 Jul; 13(7):e0199682.
Application：WB-Ti, Mouse, Mouse liver, Skin.
-
Increased hydrophilic plasma bile acids are correlated with protection from adiposity in skin-specific stearoyl-CoA desaturase-1 deficient mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com