Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GRAP2 monoclonal antibody (M01), clone 1G12

  • Catalog # : H00009402-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant GRAP2.
  • Immunogen:
  • GRAP2 (AAH25692, 226 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • HHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009402-M01
    Western Blot detection against Immunogen (35.64 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • GRAP2 monoclonal antibody (M01), clone 1G12 Western Blot analysis of GRAP2 expression in Jurkat ( Cat # L017V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of GRAP2 expression in transfected 293T cell line by GRAP2 monoclonal antibody (M01), clone 1G12.

    Lane 1: GRAP2 transfected lysate(38 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to GRAP2 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml]
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of GRAP2 transfected lysate using anti-GRAP2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GRAP2 monoclonal antibody.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged GRAP2 is approximately 0.03ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9402
  • Gene Name:
  • GRAP2
  • Gene Alias:
  • GADS,GRAP-2,GRB2L,GRBLG,GRID,GRPL,GrbX,Grf40,Mona,P38
  • Gene Description:
  • GRB2-related adaptor protein 2
  • Gene Summary:
  • This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an SH2 domain flanked by two SH3 domains. This protein interacts with other proteins, such as GRB2-associated binding protein 1 (GAB1) and the SLP-76 leukocyte protein (LCP2), through its SH3 domains. Transcript variants utilizing alternative polyA sites exist. [provided by RefSeq
  • Other Designations:
  • GRB-2-like protein,GRB2-related protein with insert domain,OTTHUMP00000028837,SH3-SH2-SH3 adaptor molecule,growth factor receptor-binding protein,growth factor receptor-bound protein 2-related adaptor protein 2,hematopoietic cell-associated adaptor protei
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook