GRAP2 monoclonal antibody (M01), clone 1G12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
GRAP2 monoclonal antibody (M01), clone 1G12 Western Blot analysis of GRAP2 expression in Jurkat ( Cat # L017V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of GRAP2 expression in transfected 293T cell line by GRAP2 monoclonal antibody (M01), clone 1G12.
Lane 1: GRAP2 transfected lysate(38 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GRAP2 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml]
Immunoprecipitation
Immunoprecipitation of GRAP2 transfected lysate using anti-GRAP2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GRAP2 monoclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GRAP2 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GRAP2.
Immunogen
GRAP2 (AAH25692, 226 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHN
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GRAP2 monoclonal antibody (M01), clone 1G12 Western Blot analysis of GRAP2 expression in Jurkat ( Cat # L017V1 ).Western Blot (Transfected lysate)
Western Blot analysis of GRAP2 expression in transfected 293T cell line by GRAP2 monoclonal antibody (M01), clone 1G12.
Lane 1: GRAP2 transfected lysate(38 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GRAP2 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of GRAP2 transfected lysate using anti-GRAP2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GRAP2 monoclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GRAP2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — GRAP2
Entrez GeneID
9402GeneBank Accession#
BC025692Protein Accession#
AAH25692Gene Name
GRAP2
Gene Alias
GADS, GRAP-2, GRB2L, GRBLG, GRID, GRPL, GrbX, Grf40, Mona, P38
Gene Description
GRB2-related adaptor protein 2
Omim ID
604518Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an SH2 domain flanked by two SH3 domains. This protein interacts with other proteins, such as GRB2-associated binding protein 1 (GAB1) and the SLP-76 leukocyte protein (LCP2), through its SH3 domains. Transcript variants utilizing alternative polyA sites exist. [provided by RefSeq
Other Designations
GRB-2-like protein|GRB2-related protein with insert domain|OTTHUMP00000028837|SH3-SH2-SH3 adaptor molecule|growth factor receptor-binding protein|growth factor receptor-bound protein 2-related adaptor protein 2|hematopoietic cell-associated adaptor protei
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com