GRAP2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human GRAP2 protein.
Immunogen
GRAP2 (NP_004801.1, 1 a.a. ~ 330 a.a) full-length human protein.
Sequence
MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GRAP2 MaxPab rabbit polyclonal antibody. Western Blot analysis of GRAP2 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of GRAP2 expression in transfected 293T cell line (H00009402-T03) by GRAP2 MaxPab polyclonal antibody.
Lane 1: GRAP2 transfected lysate(37.90 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between GRAP2 and CSF1R. HeLa cells were stained with anti-GRAP2 rabbit purified polyclonal 1:1200 and anti-CSF1R mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — GRAP2
Entrez GeneID
9402GeneBank Accession#
NM_004810Protein Accession#
NP_004801.1Gene Name
GRAP2
Gene Alias
GADS, GRAP-2, GRB2L, GRBLG, GRID, GRPL, GrbX, Grf40, Mona, P38
Gene Description
GRB2-related adaptor protein 2
Omim ID
604518Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an SH2 domain flanked by two SH3 domains. This protein interacts with other proteins, such as GRB2-associated binding protein 1 (GAB1) and the SLP-76 leukocyte protein (LCP2), through its SH3 domains. Transcript variants utilizing alternative polyA sites exist. [provided by RefSeq
Other Designations
GRB-2-like protein|GRB2-related protein with insert domain|OTTHUMP00000028837|SH3-SH2-SH3 adaptor molecule|growth factor receptor-binding protein|growth factor receptor-bound protein 2-related adaptor protein 2|hematopoietic cell-associated adaptor protei
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com