Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC22A13 (Human) Recombinant Protein (Q01)

  • Catalog # : H00009390-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SLC22A13 partial ORF ( NP_004247, 38 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • AHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLMFRPPPANASLQDILSHRFNETQPCDMGWEYPENRLPSLKNEFNLVCDRKHLKDT
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.96
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009390-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9390
  • Gene Name:
  • SLC22A13
  • Gene Alias:
  • OAT10,OCTL1,OCTL3,ORCTL-3,ORCTL3
  • Gene Description:
  • solute carrier family 22 (organic anion transporter), member 13
  • Gene Summary:
  • This gene encodes a member of the organic-cation transporter family. It is located in a gene cluster with another member of the family, organic cation transporter like 4. The encoded protein is a transmembrane protein involved in the transport of small molecules. This protein can function to mediate urate uptake and is a high affinity nicotinate exchanger in the kidneys and the intestine. [provided by RefSeq
  • Other Designations:
  • organic cationic transporter-like 3,organic-cation transporter like 3,solute carrier family 22, member 13
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook