NRXN1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant NRXN1.
Immunogen
NRXN1 (NP_004792, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Sequence
LEFPGAEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — NRXN1
Entrez GeneID
9378GeneBank Accession#
NM_004801Protein Accession#
NP_004792Gene Name
NRXN1
Gene Alias
DKFZp313P2036, FLJ35941, Hs.22998, KIAA0578
Gene Description
neurexin 1
Omim ID
600565Gene Ontology
HyperlinkGene Summary
Neurexins function in the vertebrate nervous system as cell adhesion molecules and receptors. Two neurexin genes are among the largest known in human (NRXN1 and NRXN3). By using alternate promoters, splice sites and exons, predictions of hundreds or even thousands of distinct mRNAs have been made. Most transcripts use the upstream promoter and encode alpha-neurexin isoforms; fewer transcripts are produced from the downstream promoter and encode beta-neurexin isoforms. Alpha-neurexins contain epidermal growth factor-like (EGF-like) sequences and laminin G domains, and they interact with neurexophilins. Beta-neurexins lack EGF-like sequences and contain fewer laminin G domains than alpha-neurexins. The RefSeq Project has decided to create only a few representative transcript variants of the multitude that are possible. [provided by RefSeq
Other Designations
neurexin I
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Differentially expressed gene profile in the 6-hydroxy-dopamine-induced cell culture model of Parkinson's disease.
Noelker C, Schwake M, Balzer-Geldsetzer M, Bacher M, Popp J, Schlegel J, Eggert K, Oertel WH, Klockgether T, Dodel R.
Neuroscience Letters 2012 Jan; 507(1):10.
Application:WB, Human, SH-SY5Y cells.
-
Cdk5 Promotes Synaptogenesis by Regulating the Subcellular Distribution of the MAGUK Family Member CASK.
Samuels BA, Hsueh YP, Shu T, Liang H, Tseng HC, Hong CJ, Su SC, Volker J, Neve RL, Yue DT, Tsai LH.
Neuron 2007 Dec; 56(5):823.
Application:IP, Mouse, Mouse brain.
-
Differentially expressed gene profile in the 6-hydroxy-dopamine-induced cell culture model of Parkinson's disease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com