Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPT2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00009374-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PPT2 partial ORF ( NP_005146, 203 a.a. - 302 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • DHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQSSFFGFYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYETCIEPWLS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009374-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9374
  • Gene Name:
  • PPT2
  • Gene Alias:
  • C6orf8,DKFZp564P1516,G14
  • Gene Description:
  • palmitoyl-protein thioesterase 2
  • Gene Summary:
  • This gene encodes a member of the palmitoyl-protein thioesterase family. The encoded glycosylated lysosomal protein has palmitoyl-CoA hydrolase activity in vitro, but does not hydrolyze palmitate from cysteine residues in proteins. Three transcript variants encoding different isoforms have been described for this gene, with one of the isoforms being inactive. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000029377,OTTHUMP00000029378,OTTHUMP00000029380,VE-statin2,palmitoyl-protein hydrolase 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook