RAB9A monoclonal antibody (M01), clone 1E12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RAB9A.
Immunogen
RAB9A (NP_004242, 17 a.a. ~ 115 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RAB9A monoclonal antibody (M01), clone 1E12 Western Blot analysis of RAB9A expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RAB9A expression in transfected 293T cell line by RAB9A monoclonal antibody (M01), clone 1E12.
Lane 1: RAB9A transfected lysate(22.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAB9A is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of RAB9A over-expressed 293 cell line, cotransfected with RAB9A Validated Chimera RNAi ( Cat # H00009367-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RAB9A monoclonal antibody (M01), clone 1E12 (Cat # H00009367-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to RAB9A on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RAB9A
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com