Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC22A6 monoclonal antibody (M05), clone 1F2

  • Catalog # : H00009356-M05
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant SLC22A6.
  • Immunogen:
  • SLC22A6 (AAH33682, 451 a.a. ~ 550 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • TMIRQTGMGMGSTMARVGSIVSPLVSMTAELYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRKGKQTRQQQEHQKYMVPLQASAQEKNGL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009356-M05
    Western Blot detection against Immunogen (36.63 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to SLC22A6 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged SLC22A6 is 3 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9356
  • Gene Name:
  • SLC22A6
  • Gene Alias:
  • FLJ55736,HOAT1,MGC45260,OAT1,PAHT,ROAT1
  • Gene Description:
  • solute carrier family 22 (organic anion transporter), member 6
  • Gene Summary:
  • The protein encoded by this gene is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane. Four transcript variants encoding four different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • para-aminohippurate transporter,renal organic anion transporter 1,solute carrier family 22 member 6
  • RSS
  • YouTube
  • Linkedin
  • Facebook