TXNL1 monoclonal antibody (M01), clone 1A10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
TXNL1 monoclonal antibody (M01), clone 1A10 Western Blot analysis of TXNL1 expression in HL-60 ( Cat # L014V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TXNL1 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TXNL1.
Immunogen
TXNL1 (AAH01156, 190 a.a. ~ 289 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQNVNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TXNL1 monoclonal antibody (M01), clone 1A10 Western Blot analysis of TXNL1 expression in HL-60 ( Cat # L014V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TXNL1 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — TXNL1
-
Interactome
-
Disease
-
Publication Reference
-
HDAC2 and TXNL1 distinguish aneuploid from diploid colorectal cancers.
Gemoll T, Roblick UJ, Szymczak S, Braunschweig T, Becker S, Igl BW, Bruch HP, Ziegler A, Hellman U, Difilippantonio MJ, Ried T, Jornvall H, Auer G, Habermann JK.
Cellular and Molecular Life Sciences 2011 Oct; 68(19):3261.
Application：WB, IHC, Human, DLD-1, HCT116, LoVo, COLO 201, HT-29, T84, Caco-2 cells, Colorectal carcinomas.
-
HDAC2 and TXNL1 distinguish aneuploid from diploid colorectal cancers.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com