Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDST3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00009348-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NDST3 partial ORF ( NP_004775, 162 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • IGFHKTSEKSVQSFQLKGFPFSIYGNLAVKDCCINPHSPLIRVTKSSKLEKGSLPGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.52
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009348-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9348
  • Gene Name:
  • NDST3
  • Gene Alias:
  • HSST3,MGC130028,MGC130029
  • Gene Description:
  • N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3
  • Gene Summary:
  • This gene encodes a member of the heparan sulfate/heparin GlcNAc N-deacetylase/ N-sulfotransferase family. The encoded enzyme is a type II transmembrane protein that resides in the Golgi apparatus. This monomeric bifunctional enzyme catalyzes the N-deacetylation and N-sulfation of N-acetylglucosamine residues in heparan sulfate and heparin, which are the initial chemical modifications required for the biosynthesis of the functional oligosaccharide sequences that define the specific ligand binding activities of heparan sulfate and heparin. [provided by RefSeq
  • Other Designations:
  • GlcNAc N-deacetylase/ N-sulfotransferase 3,OTTHUMP00000163903,bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3,glucosaminyl N-deacetylase/N-sulfotransferase 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook