Product Browser

Last updated: 2017/6/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDST3 monoclonal antibody (M02), clone 3A9

  • Catalog # : H00009348-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant NDST3.
  • Immunogen:
  • NDST3 (NP_004775, 162 a.a. ~ 259 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • IGFHKTSEKSVQSFQLKGFPFSIYGNLAVKDCCINPHSPLIRVTKSSKLEKGSLPGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009348-M02
    Western Blot detection against Immunogen (36.52 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9348
  • Gene Name:
  • NDST3
  • Gene Alias:
  • HSST3,MGC130028,MGC130029
  • Gene Description:
  • N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3
  • Gene Summary:
  • This gene encodes a member of the heparan sulfate/heparin GlcNAc N-deacetylase/ N-sulfotransferase family. The encoded enzyme is a type II transmembrane protein that resides in the Golgi apparatus. This monomeric bifunctional enzyme catalyzes the N-deacetylation and N-sulfation of N-acetylglucosamine residues in heparan sulfate and heparin, which are the initial chemical modifications required for the biosynthesis of the functional oligosaccharide sequences that define the specific ligand binding activities of heparan sulfate and heparin. [provided by RefSeq
  • Other Designations:
  • GlcNAc N-deacetylase/ N-sulfotransferase 3,OTTHUMP00000163903,bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3,glucosaminyl N-deacetylase/N-sulfotransferase 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook