Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

B4GALT5 (Human) Recombinant Protein (Q01)

  • Catalog # : H00009334-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human B4GALT5 partial ORF ( NP_004767, 48 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • AQGILIRDNVRTIGAQVYEQVLRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERLPSMKGPIDINMSEIGMDYIHELFSKDPTIKLGG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.18
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009334-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9334
  • Gene Name:
  • B4GALT5
  • Gene Alias:
  • B4Gal-T5,BETA4-GALT-IV,MGC138470,beta4Gal-T5,beta4GalT-V,gt-V
  • Gene Description:
  • UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5
  • Gene Summary:
  • This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The function of the enzyme encoded by this gene is not clear. This gene was previously designated as B4GALT4 but was renamed to B4GALT5. In the literature it is also referred to as beta4GalT2. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031806,UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 5,UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5,beta-1,4-GalT IV,beta-1.4-galactosyltransferase V,beta4-GalT IV
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook