B4GALT5 monoclonal antibody (M01A), clone 4B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant B4GALT5.
Immunogen
B4GALT5 (NP_004767, 48 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AQGILIRDNVRTIGAQVYEQVLRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERLPSMKGPIDINMSEIGMDYIHELFSKDPTIKLGG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.18 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — B4GALT5
Entrez GeneID
9334GeneBank Accession#
NM_004776Protein Accession#
NP_004767Gene Name
B4GALT5
Gene Alias
B4Gal-T5, BETA4-GALT-IV, MGC138470, beta4Gal-T5, beta4GalT-V, gt-V
Gene Description
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5
Omim ID
604016Gene Ontology
HyperlinkGene Summary
This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The function of the enzyme encoded by this gene is not clear. This gene was previously designated as B4GALT4 but was renamed to B4GALT5. In the literature it is also referred to as beta4GalT2. [provided by RefSeq
Other Designations
OTTHUMP00000031806|UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 5|UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5|beta-1,4-GalT IV|beta-1.4-galactosyltransferase V|beta4-GalT IV
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com