B4GALT5 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human B4GALT5 full-length ORF (ADR82962.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).Sequence
MRARRGLLRLPRRSLLAALFFFSLSSSLLYFVYVAPGIVNTYLFMMQAQGILIRDNVRTIGAQVYEQVLRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERLPSMKGPIDINMSEIGMDYIHELFSKDPTIKLGGHWKPSDCMPRWKVAILIPFRNRHEHLPVLFRHLLPMLQRQRLQFAFYVVEQVGTQPFNRAMLFNVGFQEAMKDLDWDCLIFHDVDHIPESDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLNYFANITYDALYKNITVNLTPELAQVNEY
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
42.7
Interspecies Antigen Sequence
Mouse (95)
Form
Liquid
Preparation Method
in vitro wheat germ expression system with proprietary liposome technology
Purification
None
Recommend Usage
Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Antibody Production
-
Gene Info — B4GALT5
Entrez GeneID
9334GeneBank Accession#
HQ258208.1Protein Accession#
ADR82962.1Gene Name
B4GALT5
Gene Alias
B4Gal-T5, BETA4-GALT-IV, MGC138470, beta4Gal-T5, beta4GalT-V, gt-V
Gene Description
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5
Omim ID
604016Gene Ontology
HyperlinkGene Summary
This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The function of the enzyme encoded by this gene is not clear. This gene was previously designated as B4GALT4 but was renamed to B4GALT5. In the literature it is also referred to as beta4GalT2. [provided by RefSeq
Other Designations
OTTHUMP00000031806|UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 5|UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5|beta-1,4-GalT IV|beta-1.4-galactosyltransferase V|beta4-GalT IV
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com