Product Browser

Last updated: 2017/7/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GTF3C5 monoclonal antibody (M01), clone 3F10

  • Catalog # : H00009328-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant GTF3C5.
  • Immunogen:
  • GTF3C5 (NP_036219, 378 a.a. ~ 485 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • ARKPASSKYKLKDSVYIFREGALPPYRQMFYQLCDLNVEELQKIIHRNDGAENSCTERDGWCLPKTSDELRDTMSLMIRQTIRSKRPALFSSSAKADGGKEQLTYESG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009328-M01
    Western Blot detection against Immunogen (37.62 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of GTF3C5 expression in transfected 293T cell line by GTF3C5 monoclonal antibody (M01), clone 3F10.

    Lane 1: GTF3C5 transfected lysate (Predicted MW: 59.6 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of GTF3C5 transfected lysate using anti-GTF3C5 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GTF3C5 monoclonal antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9328
  • Gene Name:
  • GTF3C5
  • Gene Alias:
  • FLJ20857,TFIIIC63,TFIIICepsilon,TFiiiC2-63
  • Gene Description:
  • general transcription factor IIIC, polypeptide 5, 63kDa
  • Other Designations:
  • general transcription factor IIIC, polypeptide 5,general transcription factor IIIC, polypeptide 5 (63kD),transcription factor IIIC, 63 kD
  • RSS
  • YouTube
  • Linkedin
  • Facebook