HMGN3 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HMGN3 full-length ORF ( AAH09529, 1 a.a. - 77 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTEN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.21
Interspecies Antigen Sequence
Rat (90)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HMGN3
Entrez GeneID
9324GeneBank Accession#
BC009529Protein Accession#
AAH09529Gene Name
HMGN3
Gene Alias
DKFZp686E20226, PNAS-24, PNAS-25, TRIP7
Gene Description
high mobility group nucleosomal binding domain 3
Omim ID
604502Gene Ontology
HyperlinkGene Summary
Thyroid hormone receptors are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. The protein encoded by this gene binds thyroid hormone receptor beta, but only in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000016772|OTTHUMP00000016773|high-mobility group protein HMGN3|thyroid hormone receptor interacting protein 7|thyroid hormone receptor interactor 7
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com