Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HMGN3 (Human) Recombinant Protein (P01)

  • Catalog # : H00009324-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HMGN3 full-length ORF ( AAH09529, 1 a.a. - 77 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTEN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.21
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009324-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9324
  • Gene Name:
  • HMGN3
  • Gene Alias:
  • DKFZp686E20226,PNAS-24,PNAS-25,TRIP7
  • Gene Description:
  • high mobility group nucleosomal binding domain 3
  • Gene Summary:
  • Thyroid hormone receptors are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. The protein encoded by this gene binds thyroid hormone receptor beta, but only in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000016772,OTTHUMP00000016773,high-mobility group protein HMGN3,thyroid hormone receptor interacting protein 7,thyroid hormone receptor interactor 7
  • RSS
  • YouTube
  • Linkedin
  • Facebook