MMP20 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human MMP20 protein.
Immunogen
MMP20 (NP_004762.2, 1 a.a. ~ 483 a.a) full-length human protein.
Sequence
MKVLPASGLAVFLIMALKFSTAAPSLVAASPRTWRNNYRLAQAYLDKYYTNKEGHQIGEMVARGSNSMIRKIKELQAFFGLQVTGKLDQTTMNVIKKPRCGVPDVANYRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSSSFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSWIGC
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (88)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MMP20 MaxPab rabbit polyclonal antibody. Western Blot analysis of MMP20 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of MMP20 expression in transfected 293T cell line (H00009313-T01) by MMP20 MaxPab polyclonal antibody.
Lane 1: MMP20 transfected lysate(53.13 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MMP20
Entrez GeneID
9313GeneBank Accession#
NM_004771.3Protein Accession#
NP_004762.2Gene Name
MMP20
Gene Alias
MMP-20
Gene Description
matrix metallopeptidase 20
Gene Ontology
HyperlinkGene Summary
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The protein encoded by this gene degrades amelogenin, the major protein component of dental enamel matrix, and so the protein is thought to play a role in tooth enamel formation. A mutation in this gene, which alters the normal splice pattern and results in premature termination of the encoded protein, has been associated with amelogenesis imperfecta. This gene is part of a cluster of MMP genes that localizes to chromosome 11q22.3. [provided by RefSeq
Other Designations
enamel metalloproteinase|enamelysin|matrix metalloproteinase 20|matrix metalloproteinase 20 (enamelysin)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com