CD83 monoclonal antibody (M01), clone 3G10-1F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CD83 monoclonal antibody (M01), clone 3G10-1F4. Western Blot analysis of CD83 expression in human colon.
Western Blot (Transfected lysate)
Western Blot analysis of CD83 expression in transfected 293T cell line by CD83 monoclonal antibody (M01), clone 3G10-1F4.
Lane 1: CD83 transfected lysate (Predicted MW: 23 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of CD83 transfected lysate using anti-CD83 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CD83 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CD83 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (48.29 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CD83.
Immunogen
CD83 (AAH30830, 1 a.a. ~ 205 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (48.29 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CD83 monoclonal antibody (M01), clone 3G10-1F4. Western Blot analysis of CD83 expression in human colon.Western Blot (Transfected lysate)
Western Blot analysis of CD83 expression in transfected 293T cell line by CD83 monoclonal antibody (M01), clone 3G10-1F4.
Lane 1: CD83 transfected lysate (Predicted MW: 23 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of CD83 transfected lysate using anti-CD83 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CD83 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CD83 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — CD83
Entrez GeneID
9308GeneBank Accession#
BC030830Protein Accession#
AAH30830Gene Name
CD83
Gene Alias
BL11, HB15
Gene Description
CD83 molecule
Omim ID
604534Gene Ontology
HyperlinkGene Summary
immunoglobulin superfamily)|OTTHUMP00000016057|cell-surface glycoprotein
Other Designations
CD83 antigen|CD83 antigen (activated B lymphocytes, immunoglobulin superfamily)|OTTHUMP00000016057|cell-surface glycoprotein
-
Interactome
-
Disease
-
Publication Reference
-
Zwitterionic polymer-coated immunobeads for blood-based cancer diagnostics.
Kim G, Yong Y, Kang HJ, Park K, Kim SI, Lee M, Huh N.
Biomaterials 2014 Jan; 35(1):294.
Application：WB, Human, Plasma.
-
Zwitterionic polymer-coated immunobeads for blood-based cancer diagnostics.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com