Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ATP6V1F polyclonal antibody (A01)

  • Catalog # : H00009296-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ATP6V1F.
  • Immunogen:
  • ATP6V1F (NP_004222, 10 a.a. ~ 119 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • VIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009296-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9296
  • Gene Name:
  • ATP6V1F
  • Gene Alias:
  • ATP6S14,MGC117321,MGC126037,MGC126038,VATF,Vma7
  • Gene Description:
  • ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F
  • Gene Summary:
  • This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is the V1 domain F subunit protein. [provided by RefSeq
  • Other Designations:
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump) 14kD,ATPase, H+ transporting, lysosomal 14kD, V1 subunit F,ATPase, vacuolar, 14 kD,H(+)-transporting two-sector ATPase, 14kD subunit,V-ATPase 14 kDa subunit,V-ATPase F subunit,adenosinetriphosphata
  • RSS
  • YouTube
  • Linkedin
  • Facebook