BCL7B monoclonal antibody (M01), clone 6D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BCL7B.
Immunogen
BCL7B (NP_001698, 124 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.43 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BCL7B monoclonal antibody (M01), clone 6D2. Western Blot analysis of BCL7B expression in MCF-7.Western Blot (Transfected lysate)
Western Blot analysis of BCL7B expression in transfected 293T cell line by BCL7B monoclonal antibody (M01), clone 6D2.
Lane 1: BCL7B transfected lysate(22 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BCL7B is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to BCL7B on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — BCL7B
Entrez GeneID
9275GeneBank Accession#
NM_001707Protein Accession#
NP_001698Gene Name
BCL7B
Gene Alias
-
Gene Description
B-cell CLL/lymphoma 7B
Omim ID
605846Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains a region that is highly similar to the N-terminal segment of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. This gene is located at a chromosomal region commonly deleted in Williams syndrome. The function of this gene has not yet been determined. [provided by RefSeq
Other Designations
OTTHUMP00000025030
-
Interactome
-
Disease
-
Publication Reference
-
BCL7B, a predictor of poor prognosis of pancreatic cancers, promotes cell motility and invasion by influencing CREB signaling.
Taniuchi K, Furihata M, Naganuma S, Dabanaka K, Hanazaki K, Saibara T.
American Journal of Cancer Research 2018 Mar; 8(3):387.
Application:IF, IHC, WB, Human, Brain, lung, liver, kidney, pancreatic ducts, pancreatic cancer, PANC-1, S2-013 cells.
-
BCL7B, a predictor of poor prognosis of pancreatic cancers, promotes cell motility and invasion by influencing CREB signaling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com