Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ITGB1BP1 (Human) Recombinant Protein (P01)

  • Catalog # : H00009270-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ITGB1BP1 full-length ORF ( AAH12264, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGVGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 47.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009270-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9270
  • Gene Name:
  • ITGB1BP1
  • Gene Alias:
  • DKFZp686K08158,ICAP-1A,ICAP-1B,ICAP-1alpha,ICAP1,ICAP1A,ICAP1B
  • Gene Description:
  • integrin beta 1 binding protein 1
  • Gene Summary:
  • The cytoplasmic domains of integrins are essential for cell adhesion. The protein encoded by this gene binds to the beta1 integrin cytoplasmic domain. The interaction between this protein and beta1 integrin is highly specific. Two isoforms of this protein are derived from alternatively spliced transcripts. The shorter form of this protein does not interact with the beta1 integrin cytoplasmic domain. The longer form is a phosphoprotein and the extent of its phosphorylation is regulated by the cell-matrix interaction, suggesting an important role of this protein during integrin-dependent cell adhesion. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000195586,bodenin,integrin cytoplasmic domain-associated protein 1,integrin cytoplasmic domain-associated protein 1-alpha,integrin cytoplasmic domain-associated protein 1-beta
  • RSS
  • YouTube
  • Linkedin
  • Facebook