CYTH2 monoclonal antibody (M02), clone 6H5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CYTH2.
Immunogen
CYTH2 (NP_059431, 314 a.a. ~ 398 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQE
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.09 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CYTH2 monoclonal antibody (M02), clone 6H5 Western Blot analysis of CYTH2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of CYTH2 expression in transfected 293T cell line by CYTH2 monoclonal antibody (M02), clone 6H5.
Lane 1: CYTH2 transfected lysate(46.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CYTH2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CYTH2 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CYTH2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CYTH2
Entrez GeneID
9266GeneBank Accession#
NM_017457Protein Accession#
NP_059431Gene Name
CYTH2
Gene Alias
ARNO, CTS18, CTS18.1, PSCD2, PSCD2L, SEC7L, Sec7p-L, Sec7p-like
Gene Description
cytohesin 2
Omim ID
602488Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The encoded protein exhibits GEP activity in vitro with ARF1, ARF3, and ARF6 and is 83% homologous to CYTH1. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
ARF exchange factor|ARF nucleotide-binding site opener|pleckstrin homology, Sec7 and coiled-coil domains 2 (cytohesin-2)|pleckstrin homology, Sec7 and coiled-coil domains 2-like|pleckstrin homology, Sec7 and coiled/coil domains 2 (cytohesin-2)
-
Interactome
-
Publication Reference
-
Systemically administered wound-homing peptide accelerates wound healing by modulating syndecan-4 function.
Horacio Maldonado, Bryan D Savage, Harlan R Barker, Ulrike May, Maria Vähätupa, Rahul K Badiani, Katarzyna I Wolanska, Craig M J Turner, Toini Pemmari, Tuomo Ketomäki, Stuart Prince, Martin J Humphries, Erkki Ruoslahti, Mark R Morgan, Tero A H Järvinen.
Nature Communications 2023 Dec; 14(1):8069.
Application:WB, Human, HaCaT cells.
-
ARNO regulates VEGF-dependent tissue responses by stabilizing endothelial VEGFR-2 surface expression.
Mannell HK, Pircher J, Chaudhry DI, Alig SK, Koch EG, Mettler R, Pohl U, Krotz F.
Cardiovascular Research 2012 Jan; 93(1):111.
Application:IF, IHC-Fr, Mouse, Mouse aorta.
-
Systemically administered wound-homing peptide accelerates wound healing by modulating syndecan-4 function.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com