CRLF1 monoclonal antibody (M01), clone 4F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CRLF1 expression in transfected 293T cell line by CRLF1 monoclonal antibody (M01), clone 4F4.
Lane 1: CRLF1 transfected lysate(46.3 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of CRLF1 transfected lysate using anti-CRLF1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CRLF1 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CRLF1 is approximately 0.03ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of CRLF1 over-expressed 293 cell line, cotransfected with CRLF1 Validated Chimera RNAi ( Cat # H00009244-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CRLF1 monoclonal antibody (M01), clone 4F4 (Cat # H00009244-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (36.3 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CRLF1.
Immunogen
CRLF1 (NP_004741, 135 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDIL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.3 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CRLF1 expression in transfected 293T cell line by CRLF1 monoclonal antibody (M01), clone 4F4.
Lane 1: CRLF1 transfected lysate(46.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of CRLF1 transfected lysate using anti-CRLF1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CRLF1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CRLF1 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of CRLF1 over-expressed 293 cell line, cotransfected with CRLF1 Validated Chimera RNAi ( Cat # H00009244-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CRLF1 monoclonal antibody (M01), clone 4F4 (Cat # H00009244-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — CRLF1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com