Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MSC (Human) Recombinant Protein (Q01)

  • Catalog # : H00009242-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MSC partial ORF ( NP_005089.1, 103 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • ECKQSQRNAANARERARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTWPFVVSGRP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.2
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009242-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9242
  • Gene Name:
  • MSC
  • Gene Alias:
  • ABF-1,ABF1,MYOR,bHLHa22
  • Gene Description:
  • musculin (activated B-cell factor-1)
  • Gene Summary:
  • The protein encoded by this gene is a transcriptional repressor capable of binding an E-box element either as a homodimer or as a heterodimer with E2A in vitro. The encoded protein also forms heterodimers with E2A proteins in vivo. This protein is capable of inhibiting the transactivation capability of E47, an E2A protein, in mammalian cells. This gene is a downstream target of the B-cell receptor signal transduction pathway. [provided by RefSeq
  • Other Designations:
  • activated B-cell factor 1, homolog of mouse musculin,activated B-cell factor-1,musculin
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook