NOG MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human NOG protein.
Immunogen
NOG (NP_005441.1, 1 a.a. ~ 232 a.a) full-length human protein.
Sequence
MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
NOG MaxPab rabbit polyclonal antibody. Western Blot analysis of NOG expression in human liver.Western Blot (Cell lysate)
NOG MaxPab rabbit polyclonal antibody. Western Blot analysis of NOG expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of NOG expression in transfected 293T cell line (H00009241-T02) by NOG MaxPab polyclonal antibody.
Lane 1: NOG transfected lysate(25.80 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of NOG transfected lysate using anti-NOG MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with NOG purified MaxPab mouse polyclonal antibody (B01P) (H00009241-B01P). -
Gene Info — NOG
Entrez GeneID
9241GeneBank Accession#
NM_005450Protein Accession#
NP_005441.1Gene Name
NOG
Gene Alias
SYM1, SYNS1
Gene Description
noggin
Gene Ontology
HyperlinkGene Summary
The secreted polypeptide, encoded by this gene, binds and inactivates members of the transforming growth factor-beta (TGF-beta) superfamily signaling proteins, such as bone morphogenetic protein-4 (BMP4). By diffusing through extracellular matrices more efficiently than members of the TGF-beta superfamily, this protein may have a principal role in creating morphogenic gradients. The protein appears to have pleiotropic effect, both early in development as well as in later stages. It was originally isolated from Xenopus based on its ability to restore normal dorsal-ventral body axis in embryos that had been artificially ventralized by UV treatment. The results of the mouse knockout of the ortholog suggest that it is involved in numerous developmental processes, such as neural tube fusion and joint formation. Recently, several dominant human NOG mutations in unrelated families with proximal symphalangism (SYM1) and multiple synostoses syndrome (SYNS1) were identified; both SYM1 and SYNS1 have multiple joint fusion as their principal feature, and map to the same region (17q22) as this gene. All of these mutations altered evolutionarily conserved amino acid residues. The amino acid sequence of this human gene is highly homologous to that of Xenopus, rat and mouse. [provided by RefSeq
Other Designations
symphalangism 1 (proximal)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com