Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MAGI1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00009223-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MAGI1 partial ORF ( NP_004733, 761 a.a. - 859 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQDIFLWRKETGFGFRILGGN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009223-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9223
  • Gene Name:
  • MAGI1
  • Gene Alias:
  • AIP3,BAIAP1,BAP1,MAGI-1,TNRC19,WWP3
  • Gene Description:
  • membrane associated guanylate kinase, WW and PDZ domain containing 1
  • Gene Summary:
  • The protein encoded by this gene is a member of the membrane-associated guanylate kinase homologue (MAGUK) family. MAGUK proteins participate in the assembly of multiprotein complexes on the inner surface of the plasma membrane at regions of cell-cell contact. The product of this gene may play a role as scaffolding protein at cell-cell junctions. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
  • Other Designations:
  • BAI1-associated protein 1,WW domain-containing protein 3,atrophin-1 interacting protein 3,membrane associated guanylate kinase inverted-1,trinucleotide repeat-containing gene 19
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook