VAPA monoclonal antibody (M01), clone 4C12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
VAPA monoclonal antibody (M01), clone 4C12. Western Blot analysis of VAPA expression in human placenta.
Western Blot (Cell lysate)
VAPA monoclonal antibody (M01), clone 4C12. Western Blot analysis of VAPA expression in K-562.
Western Blot (Transfected lysate)
Western Blot analysis of VAPA expression in transfected 293T cell line by VAPA monoclonal antibody (M01), clone 4C12.
Lane 1: VAPA transfected lysate(27.3 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged VAPA is 0.1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to VAPA on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (52.36 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant VAPA.
Immunogen
VAPA (AAH02992, 1 a.a. ~ 242 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (52.36 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
VAPA monoclonal antibody (M01), clone 4C12. Western Blot analysis of VAPA expression in human placenta.Western Blot (Cell lysate)
VAPA monoclonal antibody (M01), clone 4C12. Western Blot analysis of VAPA expression in K-562.Western Blot (Transfected lysate)
Western Blot analysis of VAPA expression in transfected 293T cell line by VAPA monoclonal antibody (M01), clone 4C12.
Lane 1: VAPA transfected lysate(27.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged VAPA is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to VAPA on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — VAPA
Entrez GeneID
9218GeneBank Accession#
BC002992Protein Accession#
AAH02992Gene Name
VAPA
Gene Alias
MGC3745, VAP-33, VAP-A, VAP33, hVAP-33
Gene Description
VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa
Omim ID
605703Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein complex assembly and cell motility. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq
Other Designations
VAMP (vesicle-associated membrane protein)-associated protein A (33kD)|vesicle-associated membrane protein-associated protein A
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com