Product Browser

Last updated: 2017/11/19
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

VAPA MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00009218-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human VAPA protein.
  • Immunogen:
  • VAPA (ENSP00000217602, 1 a.a. ~ 242 a.a) full-length human protein.
  • Sequence:
  • MAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of VAPA transfected lysate using anti-VAPA MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with VAPA purified MaxPab mouse polyclonal antibody (B01P) (H00009218-B01P).
  • PDF DownloadProtocol Download
  • Application Image
  • Gene Information
  • Entrez GeneID:
  • 9218
  • Gene Name:
  • VAPA
  • Gene Alias:
  • MGC3745,VAP-33,VAP-A,VAP33,hVAP-33
  • Gene Description:
  • VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa
  • Gene Summary:
  • The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein complex assembly and cell motility. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq
  • Other Designations:
  • VAMP (vesicle-associated membrane protein)-associated protein A (33kD),vesicle-associated membrane protein-associated protein A
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook