VAPA MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human VAPA protein.
Immunogen
VAPA (ENSP00000217602, 1 a.a. ~ 242 a.a) full-length human protein.
Sequence
MAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (96)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Immunoprecipitation
Immunoprecipitation of VAPA transfected lysate using anti-VAPA MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with VAPA purified MaxPab mouse polyclonal antibody (B01P) (H00009218-B01P). -
Gene Info — VAPA
Entrez GeneID
9218GeneBank Accession#
ENST00000349843Protein Accession#
ENSP00000217602Gene Name
VAPA
Gene Alias
MGC3745, VAP-33, VAP-A, VAP33, hVAP-33
Gene Description
VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa
Omim ID
605703Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein complex assembly and cell motility. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq
Other Designations
VAMP (vesicle-associated membrane protein)-associated protein A (33kD)|vesicle-associated membrane protein-associated protein A
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Molecular partners of hNOT/ALG3, the human counterpart of the Drosophila NOT and yeast ALG3 gene, suggest its involvement in distinct cellular processes relevant to congenital disorders of glycosylation, cancer, neurodegeneration and a variety of further pathologies.
Hacker B, Schultheiß C, Döring M, Kurzik-Dumke U.
Human Molecular Genetics 2018 Jun; 27(11):1858.
Application:IP, Human, HEK 293 cells.
-
Molecular partners of hNOT/ALG3, the human counterpart of the Drosophila NOT and yeast ALG3 gene, suggest its involvement in distinct cellular processes relevant to congenital disorders of glycosylation, cancer, neurodegeneration and a variety of further pathologies.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com