Product Browser

Last updated: 2014/10/27
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FAIM3 monoclonal antibody (M01), clone 1E4

  • Catalog # : H00009214-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant FAIM3.
  • Immunogen:
  • FAIM3 (AAH06401, 124 a.a. ~ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • SEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009214-M01
    Western Blot detection against Immunogen (36.63 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • FAIM3 monoclonal antibody (M01), clone 1E4 Western Blot analysis of FAIM3 expression in K-562 ( Cat # L009V1 ).
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FAIM3 expression in transfected 293T cell line by FAIM3 monoclonal antibody (M01), clone 1E4.

    Lane 1: FAIM3 transfected lysate(43.1 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged FAIM3 is approximately 0.03ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9214
  • Gene Name:
  • FAIM3
  • Gene Alias:
  • TOSO
  • Gene Description:
  • Fas apoptotic inhibitory molecule 3
  • Other Designations:
  • OTTHUMP00000034619,regulator of Fas-induced apoptosis
  • RSS
  • YouTube
  • Linkedin
  • Facebook