- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25865)
- MaxPab® Ab (16222)
- Monoclonal Ab (21397)
- Polyclonal Ab (27485)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9169)
- Ab Pairs/Kits (7698)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2015)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2113)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (17916)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
- Related Product Showcase
- By Research Area
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > Monoclonal Ab > Human > Apoptosis > FAIM3 monoclonal antibody (M01), clone 1E4
FAIM3 monoclonal antibody (M01), clone 1E4
- Catalog # : H00009214-M01
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 100 ug
- USD $ 319
- order now, ship next day
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Mouse monoclonal antibody raised against a partial recombinant FAIM3.
- Immunogen:
- FAIM3 (AAH06401, 124 a.a. ~ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Sequence:
- SEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQ
- Host:
- Mouse
- Reactivity:
- Human
- Isotype:
- IgG2b Kappa
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- MSDS:
Download
- Publication Reference
- 1.
- Toso, a Functional IgM Receptor, Is Regulated by IL-2 in T and NK Cells.
Murakami Y, Narayanan S, Su S, Childs R, Krzewski K, Borrego F, Weck J, Coligan JE.J Immunol. 2012 Jun 6.
- 2.
- Enhanced levels of both membrane-bound and soluble forms of IgM Fc receptor in patients with chronic lymphocytic leukemia.
Li FJ, Kubagawa Y, McCollum MK, Wilson L, Motohashi T, Bertoli LF, Barton JC, Barnes S, Davis RS, Kubagawa H.Blood. 2011 Sep 9.
- 3.
- SAGE analysis demonstrates increased expression of TOSO contributing to Fas mediated resistance in CLL.
Proto-Siqueira R, Panepucci RA, Careta FP, Lee A, Clear A, Morris K, Owen C, Rizzatti EG, Silva-Jr WA, Falcao RP, Zago MA, Gribben JG.Blood. 2008 Jul 15;112(2):394-7. Epub 2008 Apr 23.
- Applications
- Western Blot (Cell lysate)
- FAIM3 monoclonal antibody (M01), clone 1E4 Western Blot analysis of FAIM3 expression in K-562 ( Cat # L009V1 ).
- Protocol Download
- Western Blot (Transfected lysate)
- Western Blot analysis of FAIM3 expression in transfected 293T cell line by FAIM3 monoclonal antibody (M01), clone 1E4.
Lane 1: FAIM3 transfected lysate(43.1 KDa).
Lane 2: Non-transfected lysate. - Protocol Download
- Western Blot (Recombinant protein)
- Protocol Download
- Sandwich ELISA (Recombinant protein)
- Detection limit for recombinant GST tagged FAIM3 is approximately 0.03ng/ml as a capture antibody.
- Protocol Download
