SLC33A1 monoclonal antibody (M07), clone 3A4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SLC33A1 monoclonal antibody (M07), clone 3A4 Western Blot analysis of SLC33A1 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of SLC33A1 expression in transfected 293T cell line by SLC33A1 monoclonal antibody (M07), clone 3A4.
Lane 1: SLC33A1 transfected lysate(60.9 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SLC33A1 is 0.03 ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of SLC33A1 over-expressed 293 cell line, cotransfected with SLC33A1 Validated Chimera RNAi ( Cat # H00009197-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SLC33A1 monoclonal antibody (M07), clone 3A4 (Cat # H00009197-M07 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (33.33 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SLC33A1.
Immunogen
SLC33A1 (NP_004724, 1 a.a. ~ 69 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFR
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.33 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SLC33A1 monoclonal antibody (M07), clone 3A4 Western Blot analysis of SLC33A1 expression in PC-12 ( Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of SLC33A1 expression in transfected 293T cell line by SLC33A1 monoclonal antibody (M07), clone 3A4.
Lane 1: SLC33A1 transfected lysate(60.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SLC33A1 is 0.03 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of SLC33A1 over-expressed 293 cell line, cotransfected with SLC33A1 Validated Chimera RNAi ( Cat # H00009197-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SLC33A1 monoclonal antibody (M07), clone 3A4 (Cat # H00009197-M07 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — SLC33A1
Entrez GeneID
9197GeneBank Accession#
NM_004733Protein Accession#
NP_004724Gene Name
SLC33A1
Gene Alias
ACATN, AT-1, AT1, SPG42
Gene Description
solute carrier family 33 (acetyl-CoA transporter), member 1
Omim ID
603690Gene Ontology
HyperlinkGene Summary
The encoded protein is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm. [provided by RefSeq
Other Designations
acetyl-Coenzyme A transporter|acetyl-coenzyme A transporter|spastic paraplegia 42 (autosomal dominant)
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
SLC33A1/AT-1 protein regulates the induction of autophagy downstream of IRE1/XBP1 pathway.
Pehar M, Jonas MC, Hare TM, Puglielli L.
The Journal of Biological Chemistry 2012 Aug; 287(35):29921.
Application：IEM, IF, WB, Human, H4 cells.
-
AT-1 is the ER membrane acetyl-CoA transporter and is essential for cell viability.
Jonas MC, Pehar M, Puglielli L.
Journal of Cell Science 2010 Oct; 123(Pt 19):3378.
Application：WB-Ce, WB-Tr, Human, Mouse, CHO, H4 cells.
-
SLC33A1/AT-1 protein regulates the induction of autophagy downstream of IRE1/XBP1 pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com