OSMR purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human OSMR protein.
Immunogen
OSMR (AAH10943, 1 a.a. ~ 342 a.a) full-length human protein.
Sequence
MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQDSQETYNFTLIAENYLRKRSVNILFNLTHRGETRVVTAHRGH
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of OSMR expression in transfected 293T cell line (H00009180-T01) by OSMR MaxPab polyclonal antibody.
Lane 1: OSMR transfected lysate(37.62 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — OSMR
Entrez GeneID
9180GeneBank Accession#
BC010943Protein Accession#
AAH10943Gene Name
OSMR
Gene Alias
MGC150626, MGC150627, MGC75127, OSMRB
Gene Description
oncostatin M receptor
Omim ID
601743Gene Ontology
HyperlinkGene Summary
Oncostatin M is a member of the IL6 family of cytokines. Functional receptors for IL6 family cytokines are multisubunit complexes involving members of the hematopoietin receptor superfamily. Many IL6 cytokines utilize gp130 as a common receptor subunit. OSM binds to the gp130 receptor subunit and, in association with the leukemia inhibitory factor receptor, induces a proliferative response in permissive cells. OSMR is an alternative subunit (for an OSM receptor complex (a heterodimer of gp130 and OSMR) that is activated by OSM but not by LIF [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
OSMR controls glioma stem cell respiration and confers resistance of glioblastoma to ionizing radiation.
Ahmad Sharanek, Audrey Burban, Matthew Laaper, Emilie Heckel, Jean-Sebastien Joyal, Vahab D Soleimani, Arezu Jahani-Asl.
Nature Communications 2020 Aug; 11(1):4116.
Application:IF, IP, PLA-Ce, Human, Human brain tumor stem cells.
-
OSMR controls glioma stem cell respiration and confers resistance of glioblastoma to ionizing radiation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com