EBAG9 monoclonal antibody (M04), clone 4A10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
EBAG9 monoclonal antibody (M04), clone 4A10. Western Blot analysis of EBAG9 expression in HepG2.
Western Blot (Transfected lysate)
Western Blot analysis of EBAG9 expression in transfected 293T cell line by EBAG9 monoclonal antibody (M04), clone 4A10.
Lane 1: EBAG9 transfected lysate (Predicted MW: 23.54 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EBAG9 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (49.17 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant EBAG9.
Immunogen
EBAG9 (AAH17729, 1 a.a. ~ 213 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (94)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (49.17 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EBAG9 monoclonal antibody (M04), clone 4A10. Western Blot analysis of EBAG9 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of EBAG9 expression in transfected 293T cell line by EBAG9 monoclonal antibody (M04), clone 4A10.
Lane 1: EBAG9 transfected lysate (Predicted MW: 23.54 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EBAG9 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — EBAG9
Entrez GeneID
9166GeneBank Accession#
BC017729Protein Accession#
AAH17729Gene Name
EBAG9
Gene Alias
EB9, PDAF, RCAS1
Gene Description
estrogen receptor binding site associated, antigen, 9
Omim ID
605772Gene Ontology
HyperlinkGene Summary
This gene was identified as an estrogen-responsive gene. Regulation of transcription by estrogen is mediated by estrogen receptor which binds to the estrogen-responsive element (ERE) found in the 5'-flanking region of this gene. The encoded protein is a tumor-associated antigen that is expressed at high frequency in a variety of cancers. Two transcript variants differing in the 5' UTR, but encoding the same protein, have been identified for this gene. [provided by RefSeq
Other Designations
cancer associated surface antigen|estrogen receptor binding site associated antigen 9
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com