Product Browser

Last updated: 2017/8/13
  • Related Product Showcase
  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EXO1 polyclonal antibody (A01)

  • Catalog # : H00009156-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant EXO1.
  • Immunogen:
  • EXO1 (AAH07491, 747 a.a. ~ 846 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ADSLSTTKIKPLGPARASGLSKKPASIQKRKHHNAENKPGLQIKLNELWKNFGFKKDSEKLPPCKKPLSPVRDNIQLTPEAEEDIFNKPECGRVQRAIFQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009156-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9156
  • Gene Name:
  • EXO1
  • Gene Alias:
  • HEX1,hExoI
  • Gene Description:
  • exonuclease 1
  • Gene Summary:
  • This gene encodes a protein with 5' to 3' exonuclease activity as well as an RNase H activity. It is similar to the Saccharomyces cerevisiae protein Exo1 which interacts with Msh2 and which is involved in mismatch repair and recombination. Alternative splicing of this gene results in three transcript variants encoding two different isoforms. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000037878,OTTHUMP00000037879,rad2 nuclease family member, homolog of S. cerevisiae exonuclease 1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook