HGS monoclonal antibody (M01), clone 6D11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
HGS monoclonal antibody (M01), clone 6D11 Western Blot analysis of HGS expression in K-562 ( Cat # L009V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of HGS expression in transfected 293T cell line by HGS monoclonal antibody (M01), clone 6D11.
Lane 1: HGS transfected lysate(86.2 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HGS is approximately 0.03ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of HGS over-expressed 293 cell line, cotransfected with HGS Validated Chimera RNAi ( Cat # H00009146-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with HGS monoclonal antibody (M01), clone 6D11 (Cat # H00009146-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Immunofluorescence
Immunofluorescence of monoclonal antibody to HGS on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HGS.
Immunogen
HGS (AAH03565, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (92)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HGS monoclonal antibody (M01), clone 6D11 Western Blot analysis of HGS expression in K-562 ( Cat # L009V1 ).Western Blot (Transfected lysate)
Western Blot analysis of HGS expression in transfected 293T cell line by HGS monoclonal antibody (M01), clone 6D11.
Lane 1: HGS transfected lysate(86.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HGS is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of HGS over-expressed 293 cell line, cotransfected with HGS Validated Chimera RNAi ( Cat # H00009146-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with HGS monoclonal antibody (M01), clone 6D11 (Cat # H00009146-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to HGS on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — HGS
Entrez GeneID
9146GeneBank Accession#
BC003565Protein Accession#
AAH03565Gene Name
HGS
Gene Alias
HRS, ZFYVE8
Gene Description
hepatocyte growth factor-regulated tyrosine kinase substrate
Omim ID
604375Gene Ontology
HyperlinkOther Designations
human growth factor-regulated tyrosine kinase substrate
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The Class III Kinase Vps34 Promotes T Lymphocyte Survival through Regulating IL-7R? Surface Expression.
McLeod IX, Zhou X, Li QJ, Wang F, He YW.
The Journal of Immunology 2011 Nov; 187(10):5051.
Application：IF, Flow Cyt, Mouse, T cells.
-
The Class III Kinase Vps34 Promotes T Lymphocyte Survival through Regulating IL-7R? Surface Expression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com